PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00889g04005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 95aa    MW: 10797.5 Da    PI: 10.7792
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00889g04005.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.26.1e-25959151
                              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                              krie+ks rq tfskRr g++KKA+ LS+LCd++va i+fss+g+l+ +ss
  Peinf101Scf00889g04005.1  9 KRIEDKSSRQATFSKRRGGLMKKAKHLSILCDVDVAAIVFSSRGRLFQFSS 59
                              79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.9E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.464161IPR002100Transcription factor, MADS-box
CDDcd002653.20E-32265No hitNo description
SuperFamilySSF554553.27E-27267IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-26323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004045.4E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MGRKKVEIKR IEDKSSRQAT FSKRRGGLMK KAKHLSILCD VDVAAIVFSS RGRLFQFSSP  60
NSGKLGTENF VDVTYKVYRK QSFEGCITNR LEASY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-20165165Myocyte-specific enhancer factor 2B
1tqe_Q2e-20165165Myocyte-specific enhancer factor 2B
1tqe_R2e-20165165Myocyte-specific enhancer factor 2B
1tqe_S2e-20165165Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006352169.12e-32PREDICTED: agamous-like MADS-box protein AGL27
SwissprotQ8RU318e-25MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLA0A0V0HZX33e-32A0A0V0HZX3_SOLCH; Putative agamous-like MADS-box protein AGL27-like
STRINGSolyc05g015730.1.13e-31(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65070.11e-24MIKC_MADS family protein